RAB4A, Recombinant, Human, aa1-218, GST-Tag (Ras-Related Protein Rab-4A)

Produktübersicht

• Artikelname: RAB4A, Recombinant, Human, aa1-218, GST-Tag (Ras-Related Protein Rab-4A)
• Artikelnummer: USB-374972
• Hersteller Artikelnummer: 374972
• Alternativnummer: USB-374972-20,USB-374972-100,USB-374972-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Protein transport. Probably involved in vesicular traffic. Source: Recombinant protein corresponding to aa1-218 from human RAB4A, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.4kD Amino Acid Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 51.4
• UniProt: P20338
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.