RAB4A, Recombinant, Human, aa1-218, GST-Tag (Ras-Related Protein Rab-4A)

Catalog Number: USB-374972
Article Name: RAB4A, Recombinant, Human, aa1-218, GST-Tag (Ras-Related Protein Rab-4A)
Biozol Catalog Number: USB-374972
Supplier Catalog Number: 374972
Alternative Catalog Number: USB-374972-20,USB-374972-100,USB-374972-1
Manufacturer: US Biological
Category: Molekularbiologie
Protein transport. Probably involved in vesicular traffic. Source: Recombinant protein corresponding to aa1-218 from human RAB4A, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.4kD Amino Acid Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 51.4
UniProt: P20338
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.