Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)
Artikelnummer:
USB-375024
Hersteller Artikelnummer:
375024
Alternativnummer:
USB-375024-20, USB-375024-200
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. Source: Recombinant protein corresponding to aa26-174 from rat Reg3a, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.5kD AA Sequence: EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten