Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)

Product Overview

• Article Name: Reg3a, Recombinant, Rat, aa26-174, His-Tag (Regenerating Islet-derived Protein 3-alpha)
• Biozol Catalog Number: USB-375024
• Supplier Catalog Number: 375024
• Alternative Catalog Number: USB-375024-20, USB-375024-200
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. Source: Recombinant protein corresponding to aa26-174 from rat Reg3a, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.5kD AA Sequence: EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 20.5
• UniProt: P35231
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.