RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)

Produktübersicht

• Artikelname: RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
• Artikelnummer: USB-375149
• Hersteller Artikelnummer: 375149
• Alternativnummer: USB-375149-20,USB-375149-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD Amino Acid Sequence: MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 42.2
• UniProt: P02358
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.