RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)

Product Overview

• Article Name: RpsF, Recombinant, E. coli, aa1-131, GST-Tag (30S Ribosomal Protein S6)
• Biozol Catalog Number: USB-375149
• Supplier Catalog Number: 375149
• Alternative Catalog Number: USB-375149-20,USB-375149-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Binds together with S18 to 16S ribosomal RNA. Source: Recombinant protein corresponding to aa1-131 from E. coli rpsF, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD Amino Acid Sequence: MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.2
• UniProt: P02358
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.