SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)

Artikelnummer: USB-375377
Artikelname: SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)
Artikelnummer: USB-375377
Hersteller Artikelnummer: 375377
Alternativnummer: USB-375377-20,USB-375377-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Recombinant protein corresponding to aa1-146 from human SPA17, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 43.8
UniProt: Q15506
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA and 50% glycerol.