SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)

Catalog Number: USB-375377
Article Name: SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)
Biozol Catalog Number: USB-375377
Supplier Catalog Number: 375377
Alternative Catalog Number: USB-375377-20,USB-375377-100
Manufacturer: US Biological
Category: Molekularbiologie
Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Recombinant protein corresponding to aa1-146 from human SPA17, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight: 43.8
UniProt: Q15506
Purity: ~90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA and 50% glycerol.