STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)

Produktübersicht

• Artikelname: STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)
• Artikelnummer: USB-375430
• Hersteller Artikelnummer: 375430
• Alternativnummer: USB-375430-20,USB-375430-100,USB-375430-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May play a protective role in mucosal tissues by preventing exaggerated allergic responses. Source: Recombinant protein corresponding to aa61-307 from human STARD7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.5kD Amino Acid Sequence: LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 56.5
• UniProt: Q9NQZ5
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.