STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)

Catalog Number: USB-375430
Article Name: STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)
Biozol Catalog Number: USB-375430
Supplier Catalog Number: 375430
Alternative Catalog Number: USB-375430-20,USB-375430-100,USB-375430-1
Manufacturer: US Biological
Category: Molekularbiologie
May play a protective role in mucosal tissues by preventing exaggerated allergic responses. Source: Recombinant protein corresponding to aa61-307 from human STARD7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.5kD Amino Acid Sequence: LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 56.5
UniProt: Q9NQZ5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.