Cytotoxic T-lymphocyte Protein 4, Recombinant Mouse, aa36-161, His-SUMO-Tag, Myc-Tag (Ctla4)

Artikelnummer: USB-405900
Artikelname: Cytotoxic T-lymphocyte Protein 4, Recombinant Mouse, aa36-161, His-SUMO-Tag, Myc-Tag (Ctla4)
Artikelnummer: USB-405900
Hersteller Artikelnummer: 405900
Alternativnummer: USB-405900-20,USB-405900-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Recombinant protein corresponding to aa36-161 from Mouse Cytotoxic T-lymphocyte protein 4, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.9kD Amino Acid Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.9
UniProt: P09793
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol