Cytotoxic T-lymphocyte Protein 4, Recombinant Mouse, aa36-161, His-SUMO-Tag, Myc-Tag (Ctla4)

Catalog Number: USB-405900
Article Name: Cytotoxic T-lymphocyte Protein 4, Recombinant Mouse, aa36-161, His-SUMO-Tag, Myc-Tag (Ctla4)
Biozol Catalog Number: USB-405900
Supplier Catalog Number: 405900
Alternative Catalog Number: USB-405900-20,USB-405900-100
Manufacturer: US Biological
Category: Molekularbiologie
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. Recombinant protein corresponding to aa36-161 from Mouse Cytotoxic T-lymphocyte protein 4, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.9kD Amino Acid Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD. Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.9
UniProt: P09793
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol