Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)

Produktübersicht

• Artikelname: Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)
• Artikelnummer: USB-405903
• Hersteller Artikelnummer: 405903
• Alternativnummer: USB-405903-20,USB-405903-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing Partial recombinant protein corresponding to aa561-730 from mouse Dedicator of cytokinesis protein 8, fused to His-Tag at N-terminal, expressed in yeast. Swiss/Uniprot: Q8C147 Molecular Weight: ~21.2kD Amino Acid Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.2
• UniProt: Q8C147
• Reinheit: ~85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.