Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)

Catalog Number: USB-405903
Article Name: Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)
Biozol Catalog Number: USB-405903
Supplier Catalog Number: 405903
Alternative Catalog Number: USB-405903-20,USB-405903-100
Manufacturer: US Biological
Category: Molekularbiologie
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing Partial recombinant protein corresponding to aa561-730 from mouse Dedicator of cytokinesis protein 8, fused to His-Tag at N-terminal, expressed in yeast. Swiss/Uniprot: Q8C147 Molecular Weight: ~21.2kD Amino Acid Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.2
UniProt: Q8C147
Purity: ~85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.