F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (caf1)

Artikelnummer: USB-405923
Artikelname: F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (caf1)
Artikelnummer: USB-405923
Hersteller Artikelnummer: 405923
Alternativnummer: USB-405923-20,USB-405923-100,USB-405923-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Recombinant protein corresponding to aa22-170 with a 6X His-Tag at the N-terminal from Yersinia Pestis F1 Capsule Antigen, expressed in E. coli. Molecular Weight: ~19.6kD Amino Acid Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. Toxicity and Hazards: All products should be handled by qualified personnel only, trained in laboratory procedures.
Molekulargewicht: 19.6
UniProt: P26948
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.