F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (caf1)

Catalog Number: USB-405923
Article Name: F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (caf1)
Biozol Catalog Number: USB-405923
Supplier Catalog Number: 405923
Alternative Catalog Number: USB-405923-20,USB-405923-100,USB-405923-1
Manufacturer: US Biological
Category: Molekularbiologie
Recombinant protein corresponding to aa22-170 with a 6X His-Tag at the N-terminal from Yersinia Pestis F1 Capsule Antigen, expressed in E. coli. Molecular Weight: ~19.6kD Amino Acid Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological. Toxicity and Hazards: All products should be handled by qualified personnel only, trained in laboratory procedures.
Molecular Weight: 19.6
UniProt: P26948
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.