Minor Allergen Can f 2, Recombinant, Canine, aa19-180, SUMO-Tag

Produktübersicht

• Artikelname: Minor Allergen Can f 2, Recombinant, Canine, aa19-180, SUMO-Tag
• Artikelnummer: USB-405991
• Hersteller Artikelnummer: 405991
• Alternativnummer: USB-405991-20,USB-405991-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa19-180 from canine Minor allergen Can f 2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.4kD Amino Acid Sequence: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 34.4
• UniProt: O18874
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.