Minor Allergen Can f 2, Recombinant, Canine, aa19-180, SUMO-Tag

Catalog Number: USB-405991
Article Name: Minor Allergen Can f 2, Recombinant, Canine, aa19-180, SUMO-Tag
Biozol Catalog Number: USB-405991
Supplier Catalog Number: 405991
Alternative Catalog Number: USB-405991-20,USB-405991-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa19-180 from canine Minor allergen Can f 2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.4kD Amino Acid Sequence: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.4
UniProt: O18874
Purity: ~90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.