Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)

Artikelnummer: USB-406022
Artikelname: Polymerase Acidic Protein, Recombinant, Influenza A virus, aa124-247, His-Tag (PA)
Artikelnummer: USB-406022
Hersteller Artikelnummer: 406022
Alternativnummer: USB-406022-20,USB-406022-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5 cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity. Source: Recombinant protein corresponding to aa124-247 from Influenza A virus Polymerase acidic protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.6kD Amino Acid Sequence: RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.6
UniProt: Q9IQ47
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.