UBE2V2 (DDVIT1, DDVit-1, EDAF-1, EDPF-1, EDPF1, MMS2, UEV-2, UEV2), Mouse

Artikelnummer: USB-470199
Artikelname: UBE2V2 (DDVIT1, DDVit-1, EDAF-1, EDPF-1, EDPF1, MMS2, UEV-2, UEV2), Mouse
Artikelnummer: USB-470199
Hersteller Artikelnummer: 470199
Alternativnummer: USB-470199-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Protein corresponding to aa1-145 from full length human UBE2V2.
Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVPTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLE DDEDMTLTRWTGMIIGPPRTNYENRVYSLKVECGPKY PEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQ NSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 007051
Reinheit: Purified
Formulierung: Supplied as a liquid in PBS, pH 7.4.