Protein corresponding to aa1-145 from full length human UBE2V2.
Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAVPTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLE DDEDMTLTRWTGMIIGPPRTNYENRVYSLKVECGPKY PEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQ NSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.