Protein A33 (A33R), Recombinant, Vaccinia Virus, aa57-185, His-Tag, Myc-Tag

Artikelnummer: USB-544574
Artikelname: Protein A33 (A33R), Recombinant, Vaccinia Virus, aa57-185, His-Tag, Myc-Tag
Artikelnummer: USB-544574
Hersteller Artikelnummer: 544574
Alternativnummer: USB-544574-20,USB-544574-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles (By similarity). Partial recombinant protein corresponding to aa57-185 from Vaccinia virus (strain Copenhagen) Protein A33 (A33R), fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Swiss/UniProt Accession: P68616. Molecular Weight: ~18.1kD Amino Acid Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.1
UniProt: P68616
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol.