Protein A33 (A33R), Recombinant, Vaccinia Virus, aa57-185, His-Tag, Myc-Tag
Biozol Catalog Number:
USB-544574
Supplier Catalog Number:
544574
Alternative Catalog Number:
USB-544574-20,USB-544574-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles (By similarity). Partial recombinant protein corresponding to aa57-185 from Vaccinia virus (strain Copenhagen) Protein A33 (A33R), fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Swiss/UniProt Accession: P68616. Molecular Weight: ~18.1kD Amino Acid Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.