Alkaline Serine Protease ver112, Recombinant, Lecanicillium psalliotae, aa103-382, His-Tag, Myc-Tag

Artikelnummer: USB-583544
Artikelname: Alkaline Serine Protease ver112, Recombinant, Lecanicillium psalliotae, aa103-382, His-Tag, Myc-Tag
Artikelnummer: USB-583544
Hersteller Artikelnummer: 583544
Alternativnummer: USB-583544-20,USB-583544-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Serine protease which can degrade the nematode cuticle. Source: Recombinant protein corresponding to aa103-382 from Lecanicillium psalliotae Alkaline serine protease ver112, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~36.0kD Amino Acid Sequence: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQTLSTKNVLTSIPSGTVNYLAFNGAT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36
UniProt: Q68GV9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol