Serine protease which can degrade the nematode cuticle. Source: Recombinant protein corresponding to aa103-382 from Lecanicillium psalliotae Alkaline serine protease ver112, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~36.0kD Amino Acid Sequence: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQTLSTKNVLTSIPSGTVNYLAFNGAT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
