C-X-C Chemokine Receptor Type 3, Recombinant, Mouse, aa1-52, His-KSI-Tag

Produktübersicht

• Artikelname: C-X-C Chemokine Receptor Type 3, Recombinant, Mouse, aa1-52, His-KSI-Tag
• Artikelnummer: USB-583856
• Hersteller Artikelnummer: 583856
• Alternativnummer: USB-583856-20,USB-583856-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response (By similarity). Binds to CCL21. Source: Recombinant protein corresponding to aa1-52 from mouse C-X-C chemokine receptor type 3, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.3kD Amino Acid Sequence: MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 21.3
• UniProt: O88410
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.