Collagen Triple Helix Repeat-containing Protein 1, Recombinant, Human, aa31-243, hFC-Tag

Produktübersicht

• Artikelname: Collagen Triple Helix Repeat-containing Protein 1, Recombinant, Human, aa31-243, hFC-Tag
• Artikelnummer: USB-584050
• Hersteller Artikelnummer: 584050
• Alternativnummer: USB-584050-20,USB-584050-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May act as a negative regulator of collagen matrix deposition. Recombinant protein corresponding to aa31-243 from human Collagen triple helix repeat-containing protein 1, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~52kD Amino Acid Sequence: SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 52
• UniProt: Q96CG8
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.