Collagen Triple Helix Repeat-containing Protein 1, Recombinant, Human, aa31-243, hFC-Tag

Product Overview

• Article Name: Collagen Triple Helix Repeat-containing Protein 1, Recombinant, Human, aa31-243, hFC-Tag
• Biozol Catalog Number: USB-584050
• Supplier Catalog Number: 584050
• Alternative Catalog Number: USB-584050-20,USB-584050-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May act as a negative regulator of collagen matrix deposition. Recombinant protein corresponding to aa31-243 from human Collagen triple helix repeat-containing protein 1, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~52kD Amino Acid Sequence: SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 52
• UniProt: Q96CG8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.