Complement Receptor Type 1, Recombinant, Human, aa41-234, GST-Tag

Artikelnummer: USB-584081
Artikelname: Complement Receptor Type 1, Recombinant, Human, aa41-234, GST-Tag
Artikelnummer: USB-584081
Hersteller Artikelnummer: 584081
Alternativnummer: USB-584081-20,USB-584081-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates cellular binding of particles and immune complexes that have activated complement. Source: Recombinant protein corresponding to aa41-234 from human Complement receptor type 1, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~48.4kD Amino Acid Sequence: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48.4
UniProt: P17927
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.