Complement Receptor Type 1, Recombinant, Human, aa41-234, GST-Tag

Product Overview

• Article Name: Complement Receptor Type 1, Recombinant, Human, aa41-234, GST-Tag
• Biozol Catalog Number: USB-584081
• Supplier Catalog Number: 584081
• Alternative Catalog Number: USB-584081-20,USB-584081-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Mediates cellular binding of particles and immune complexes that have activated complement. Source: Recombinant protein corresponding to aa41-234 from human Complement receptor type 1, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~48.4kD Amino Acid Sequence: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 48.4
• UniProt: P17927
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.