Disco-interacting Protein 2 Homolog C, Recombinant, Human, aa1-125, hFC-Tag

Produktübersicht

• Artikelname: Disco-interacting Protein 2 Homolog C, Recombinant, Human, aa1-125, hFC-Tag
• Artikelnummer: USB-584261
• Hersteller Artikelnummer: 584261
• Alternativnummer: USB-584261-20,USB-584261-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-125 from human Disco-interacting protein 2 homolog C, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~43.1kD Amino Acid Sequence: MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 43.1
• UniProt: Q9Y2E4
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.