Disco-interacting Protein 2 Homolog C, Recombinant, Human, aa1-125, hFC-Tag

Product Overview

• Article Name: Disco-interacting Protein 2 Homolog C, Recombinant, Human, aa1-125, hFC-Tag
• Biozol Catalog Number: USB-584261
• Supplier Catalog Number: 584261
• Alternative Catalog Number: USB-584261-20,USB-584261-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-125 from human Disco-interacting protein 2 homolog C, fused to hFC-Tag at C-terminal, expressed in Mammalian cell. Molecular Weight: ~43.1kD Amino Acid Sequence: MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43.1
• UniProt: Q9Y2E4
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.