DNA-binding Protein HU-beta, Recombinant, Neisseria meningitidis serogroup B, aa1-89, His-Tag

Artikelnummer: USB-584290
Artikelname: DNA-binding Protein HU-beta, Recombinant, Neisseria meningitidis serogroup B, aa1-89, His-Tag
Artikelnummer: USB-584290
Hersteller Artikelnummer: 584290
Alternativnummer: USB-584290-20,USB-584290-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. Source: Recombinant protein corresponding to aa1-89 from Neisseria meningitidis serogroup B DNA-binding protein HU-beta, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.4kD Amino Acid Sequence: MNKSELIEAIAQEADISKAAAQKALDATTNAVTTALKQGDTVTLVGFGTFYVGERAERQGRNPKTGEPLTIAAAKTPKFRAGKALKDAL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.4
UniProt: P64389
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.