Epidermal Patterning Factor-like Protein 9, Recombinant, Arabidopsis thaliana, aa32-102, His-Tag
Artikelnummer:
USB-584431
Hersteller Artikelnummer:
584431
Alternativnummer:
USB-584431-20,USB-584431-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). Source: Recombinant protein corresponding to aa32-102 from Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.2kD Amino Acid Sequence: SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten