Epidermal Patterning Factor-like Protein 9, Recombinant, Arabidopsis thaliana, aa32-102, His-Tag
Biozol Catalog Number:
USB-584431
Supplier Catalog Number:
584431
Alternative Catalog Number:
USB-584431-20,USB-584431-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1). Source: Recombinant protein corresponding to aa32-102 from Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.2kD Amino Acid Sequence: SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted