Extracellular Matrix Protein 1, Recombinant, Human, aa386-540, His-GST-Tag, Myc-Tag
Artikelnummer:
USB-584485
Hersteller Artikelnummer:
584485
Alternativnummer:
USB-584485-20,USB-584485-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity. Source: Recombinant protein corresponding to aa386-540 from human Extracellular matrix protein 1, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~52.4kD Amino Acid Sequence: HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten