Extracellular Matrix Protein 1, Recombinant, Human, aa386-540, His-GST-Tag, Myc-Tag

Product Overview

• Article Name: Extracellular Matrix Protein 1, Recombinant, Human, aa386-540, His-GST-Tag, Myc-Tag
• Biozol Catalog Number: USB-584485
• Supplier Catalog Number: 584485
• Alternative Catalog Number: USB-584485-20,USB-584485-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity. Source: Recombinant protein corresponding to aa386-540 from human Extracellular matrix protein 1, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~52.4kD Amino Acid Sequence: HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 52.4
• UniProt: Q16610
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.