Histamine H1 Receptor, Recombinant, Human, aa211-416, His-Tag

Artikelnummer: USB-584851
Artikelname: Histamine H1 Receptor, Recombinant, Human, aa211-416, His-Tag
Artikelnummer: USB-584851
Hersteller Artikelnummer: 584851
Alternativnummer: USB-584851-20,USB-584851-100
Hersteller: US Biological
Kategorie: Molekularbiologie
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. Source: Recombinant protein corresponding to aa211-416 from human Histamine H1 receptor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.1kD Amino Acid Sequence: AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.1
UniProt: P35367
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.