Histamine H1 Receptor, Recombinant, Human, aa211-416, His-Tag

Catalog Number: USB-584851
Article Name: Histamine H1 Receptor, Recombinant, Human, aa211-416, His-Tag
Biozol Catalog Number: USB-584851
Supplier Catalog Number: 584851
Alternative Catalog Number: USB-584851-20,USB-584851-100
Manufacturer: US Biological
Category: Molekularbiologie
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. Source: Recombinant protein corresponding to aa211-416 from human Histamine H1 receptor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.1kD Amino Acid Sequence: AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.1
UniProt: P35367
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.