Metallo-beta-Lactamase Type 2, Recombinant, Serratia marcescens, aa19-246, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Metallo-beta-Lactamase Type 2, Recombinant, Serratia marcescens, aa19-246, His-Tag, Myc-Tag
• Artikelnummer: USB-585377
• Hersteller Artikelnummer: 585377
• Alternativnummer: USB-585377-20,USB-585377-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Source: Recombinant protein corresponding to aa19-246 from Serratia marcescens Metallo-beta-lactamase type 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.6kD Amino Acid Sequence: AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.6
• UniProt: P52699
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.