Metallo-beta-Lactamase Type 2, Recombinant, Serratia marcescens, aa19-246, His-Tag, Myc-Tag

Catalog Number: USB-585377
Article Name: Metallo-beta-Lactamase Type 2, Recombinant, Serratia marcescens, aa19-246, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585377
Supplier Catalog Number: 585377
Alternative Catalog Number: USB-585377-20, USB-585377-100
Manufacturer: US Biological
Category: Molekularbiologie
Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Source: Recombinant protein corresponding to aa19-246 from Serratia marcescens Metallo-beta-lactamase type 2, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.6kD Amino Acid Sequence: AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.6
UniProt: P52699
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.