Myelin Protein P0, Recombinant, Human, aa30-156, GST-Tag

Produktübersicht

• Artikelname: Myelin Protein P0, Recombinant, Human, aa30-156, GST-Tag
• Artikelnummer: USB-585446
• Hersteller Artikelnummer: 585446
• Alternativnummer: USB-585446-20,USB-585446-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction. Source: Recombinant protein corresponding to aa30-156 from human Myelin protein P0, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.5kD Amino Acid Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.5
• UniProt: P25189
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.