Myelin Protein P0, Recombinant, Human, aa30-156, GST-Tag

Product Overview

• Article Name: Myelin Protein P0, Recombinant, Human, aa30-156, GST-Tag
• Biozol Catalog Number: USB-585446
• Supplier Catalog Number: 585446
• Alternative Catalog Number: USB-585446-20,USB-585446-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction. Source: Recombinant protein corresponding to aa30-156 from human Myelin protein P0, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~41.5kD Amino Acid Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 41.5
• UniProt: P25189
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.