Nucleoprotein, Recombinant, Bunyavirus La Crosse, aa1-235, His-Tag

Artikelnummer: USB-585590
Artikelname: Nucleoprotein, Recombinant, Bunyavirus La Crosse, aa1-235, His-Tag
Artikelnummer: USB-585590
Hersteller Artikelnummer: 585590
Alternativnummer: USB-585590-20, USB-585590-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Source: Recombinant protein corresponding to aa1-235 from Bunyavirus La Crosse Nucleoprotein, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.0kD Amino Acid Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29
UniProt: P04873
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.