Nucleoprotein, Recombinant, Bunyavirus La Crosse, aa1-235, His-Tag

Catalog Number: USB-585590
Article Name: Nucleoprotein, Recombinant, Bunyavirus La Crosse, aa1-235, His-Tag
Biozol Catalog Number: USB-585590
Supplier Catalog Number: 585590
Alternative Catalog Number: USB-585590-20, USB-585590-100
Manufacturer: US Biological
Category: Molekularbiologie
Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Source: Recombinant protein corresponding to aa1-235 from Bunyavirus La Crosse Nucleoprotein, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.0kD Amino Acid Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29
UniProt: P04873
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.