Phycobilisome Degradation Protein nblA, Recombinant, Synechococcus elongatus, aa1-59, His-Tag, Myc-Tag
Artikelnummer:
USB-585782
Hersteller Artikelnummer:
585782
Alternativnummer:
USB-585782-20, USB-585782-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Involved in phycobilisome (PBS) degradation during nutrient deprivation. May mark the PBS for degradation by covalent association with PBS components or may disrupt the PBS via ionic interactions. Source: Recombinant protein corresponding to aa1-59 from Synechococcus elongatus Phycobilisome degradation protein nblA, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.5kD Amino Acid Sequence: MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten