Phycobilisome Degradation Protein nblA, Recombinant, Synechococcus elongatus, aa1-59, His-Tag, Myc-Tag

Product Overview

• Article Name: Phycobilisome Degradation Protein nblA, Recombinant, Synechococcus elongatus, aa1-59, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-585782
• Supplier Catalog Number: 585782
• Alternative Catalog Number: USB-585782-20, USB-585782-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in phycobilisome (PBS) degradation during nutrient deprivation. May mark the PBS for degradation by covalent association with PBS components or may disrupt the PBS via ionic interactions. Source: Recombinant protein corresponding to aa1-59 from Synechococcus elongatus Phycobilisome degradation protein nblA, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~14.5kD Amino Acid Sequence: MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 14.5
• UniProt: P35087
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.