Receptor-binding Cancer Antigen Expressed on SiSo Cells, Recombinant, Human, aa28-213, His-SUMO-Tag

Artikelnummer: USB-586121
Artikelname: Receptor-binding Cancer Antigen Expressed on SiSo Cells, Recombinant, Human, aa28-213, His-SUMO-Tag
Artikelnummer: USB-586121
Hersteller Artikelnummer: 586121
Alternativnummer: USB-586121-20, USB-586121-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases. Source: Recombinant protein corresponding to aa28-213 from human Receptor-binding cancer antigen expressed on SiSo cells, fused to 10X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.2kD Amino Acid Sequence: RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.2
UniProt: O00559
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.