Receptor-binding Cancer Antigen Expressed on SiSo Cells, Recombinant, Human, aa28-213, His-SUMO-Tag

Product Overview

• Article Name: Receptor-binding Cancer Antigen Expressed on SiSo Cells, Recombinant, Human, aa28-213, His-SUMO-Tag
• Biozol Catalog Number: USB-586121
• Supplier Catalog Number: 586121
• Alternative Catalog Number: USB-586121-20,USB-586121-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May participate in suppression of cell proliferation and induces apoptotic cell death through activation of interleukin-1-beta converting enzyme (ICE)-like proteases. Source: Recombinant protein corresponding to aa28-213 from human Receptor-binding cancer antigen expressed on SiSo cells, fused to 10X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.2kD Amino Acid Sequence: RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 37.2
• UniProt: O00559
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.