Recombination Protein uvsY, Recombinant, Enterobacteria phage T4, aa1-137, His-Avi-Tag

Artikelnummer: USB-586137
Artikelname: Recombination Protein uvsY, Recombinant, Enterobacteria phage T4, aa1-137, His-Avi-Tag
Artikelnummer: USB-586137
Hersteller Artikelnummer: 586137
Alternativnummer: USB-586137-20, USB-586137-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA. Source: Recombinant protein corresponding to aa1-137 from Enterobacteria phage T4 Recombination protein uvsY, fused to 6X His-Avi-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.7kD Amino Acid Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 21.7
UniProt: P04537
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.